top of page

...

You might also like

IGF-1 LR3 (Receptor Grade)

Price

$240.00

IGF-1 LR3 (Receptor Grade) is a synthetic version of insulin-like growth factor, engineered for enhanced stability and potency. With a longer half-life than standard IGF-1, it is designed to support advanced research into cell growth, repair, and performance optimization at the receptor level.

Product Type

Quantity

Research

IGF-1 LR3: Molecular Profile and Mechanistic Overview

 

Insulin-Like Growth Factor-1 Long Arg³ (IGF-1 LR3) is a recombinant peptide analog of human IGF-1, modified through the substitution of an arginine residue at position 3 and the extension of the N-terminal sequence by 13 amino acids. These structural alterations significantly reduce its affinity for IGF binding proteins (IGFBPs) while extending its plasma half-life, thereby enhancing its bioavailability and duration of action at the cellular level.
 

At the molecular level, IGF-1 LR3 functions as a potent agonist of the IGF-1 receptor (IGF-1R), a transmembrane tyrosine kinase receptor that triggers downstream activation of the PI3K-Akt and MAPK-ERK signaling cascades. These pathways orchestrate a broad spectrum of anabolic and cytoprotective effects, including stimulation of myogenesisprotein synthesiscell proliferation, and tissue regeneration.

 

Physiological and Cellular Effects

 

  • Accelerated Tissue Repair: IGF-1 LR3 promotes rapid regeneration of skeletal muscle fibers, tendons, and ligaments through upregulation of satellite cell proliferation and enhanced collagen matrix synthesis, expediting recovery from structural and mechanical damage.

 

  • Anti-Inflammatory Modulation: The peptide exerts indirect anti-inflammatory effects by attenuating pro-inflammatory cytokine signaling and promoting macrophage M2 polarization, contributing to systemic and localized reduction of inflammation.

 

  • Gastrointestinal Support: IGF-1 LR3 facilitates mucosal regeneration within the gastrointestinal epithelium, reinforcing intestinal barrier integrity and supporting microbial and enzymatic homeostasis.

 

  • Stress Adaptation and Cellular Resilience: By enhancing mitochondrial biogenesis and cellular energy metabolism, IGF-1 LR3 may bolster the body’s adaptive response to oxidative and physical stress, supporting recovery and overall homeostasis.

 

  • Neuroprotective Actions: Activation of IGF-1R signaling in neuronal tissue has been linked to synaptic plasticity enhancementneuronal survival, and reduction of neuroinflammatory markers, indicating a potential role in neuroprotection and cognitive maintenance.

 

Experimental Applications

 

IGF-1 LR3 is primarily employed in in vitro and in vivo research investigating:

  • Mechanisms of skeletal muscle hypertrophy and repair
  • Tissue regeneration following injury or oxidative stress
  • Metabolic regulation, including glucose uptake and lipid oxidation
  • Neurodegenerative and anti-aging pathways

 

Due to its extended half-life and receptor specificity, IGF-1 LR3 (Receptor Grade) serves as a robust molecular probe for elucidating anabolic and regenerative signaling dynamics across multiple tissue types.

 

Legal Policy: 

This product is strictly for research purposes only and is intended solely for in vitro testing and laboratory experimentation. The information provided on this website is for educational use and does not permit the introduction of this product into humans or animals. Handling of this product is restricted to licensed and qualified professionals. It is not classified as a drug, food, or cosmetic, and should not be misrepresented or used as such.

Disclaimer

All products sold on this site are for research and development use only. They are not intended for human or animal use.

 

The statements on this website have not been evaluated by the US Food and Drug Administration (FDA). Our products and content are not intended to diagnose, treat, cure, or prevent any disease.

 

Tides Peptides is a chemical supplier, not a compounding pharmacy or a chemical compounding facility as defined under section 503A of the Federal Food, Drug, and Cosmetic Act.

Ingredients

Molecular Formula

  • Formula: C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉
  • Molecular Weight: ~9117 g/mol
  • Amino Acid Sequence: MFPAMPLLSLVLLLVPPALA GGGGGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

 

View Certificate of Analysis

 

FAQ

1. What is IGF-1 LR3, and why does it matter?
IGF-1 LR3 (Insulin-like Growth Factor-1 Long Arg3) is a synthetic peptide and a more stable version of natural IGF-1. It plays a key role in supporting cellular growth, repair, and performance at the receptor level. Due to its longer half-life, IGF-1 LR3 remains active in the body much longer than standard IGF-1, making it a valuable tool in advanced research.
 

2. What are the benefits of IGF-1 LR3?
Researchers and users associate IGF-1 LR3 with:

  • Enhanced muscle growth and recovery
  • Improved cell repair and regeneration
  • Increased protein synthesis
  • Support for fat metabolism
  • Greater endurance and performance potential


3. What is IGF-1 LR3 used for?
IGF-1 LR3 is commonly explored in research for:

  • Promoting lean muscle development

  • Supporting recovery after physical stress or injury

  • Enhancing tissue repair and regeneration

  • Studying metabolic and anti-aging pathways

  • Studying metabolic and anti-aging pathways

IGF-1 LR3 (Receptor Grade) is a highly studied peptide designed for stability and potency, offering extended activity for advanced cellular growth and repair research.

bottom of page